General Information

  • ID:  hor000665
  • Uniprot ID:  Q75V95
  • Protein name:  Calcitonin receptor-stimulating peptide 1
  • Gene name:  CRSP1
  • Organism:  Bos taurus (Bovine)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFNGPRRNSWF
  • Length:  46(80-125)
  • Propeptide:  MGFWKFPPFLVLSILVLYQAGMFHAAPFRSVFDGRFDPATLDEEESRLLLAAMVNDYEQMRARESEKAQKTEGSRIQKRACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFNGPRRNSWF
  • Signal peptide:  MGFWKFPPFLVLSILVLYQAGMFHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Mechanism:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q75V95-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000665_AF2.pdbhor000665_ESM.pdb

Physical Information

Mass: 600590 Formula: C227H359N71O60S5
Absent amino acids: DEQY Common amino acids: RS
pI: 12.34 Basic residues: 8
Polar residues: 19 Hydrophobic residues: 14
Hydrophobicity: -27.17 Boman Index: -8316
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 55.22
Instability Index: 6880 Extinction Coefficient cystines: 11125
Absorbance 280nm: 247.22

Literature

  • PubMed ID:  NA
  • Title:  Identification, structural determination, and biological activity of bovine and canine calcitonin receptor-stimulating peptides.